PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00030873001
Common NameGSBRNA2T00030873001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 263aa    MW: 29346.7 Da    PI: 8.0848
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00030873001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.1e-333588255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtp+LH++Fv+av+ LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR 
  GSBRNA2T00030873001 35 PRLRWTPDLHRCFVNAVDMLGGQHRATPKLVLKMMDVKGLTISHVKSHLQMYRG 88
                         8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3353191IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-303188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-233588IPR006447Myb domain, plants
SuperFamilySSF466891.09E-143587IPR009057Homeodomain-like
PfamPF002491.3E-83687IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGKAAGRNGN ENYNGVGFNG QRGGGVRPYV RSPVPRLRWT PDLHRCFVNA VDMLGGQHRA  60
TPKLVLKMMD VKGLTISHVK SHLQMYRGSK LTLGKPEESS SSSIRRQDTE EDNFHDNLSL  120
HTRNDCLLGF HSFPLSSHSS LRGGRKKEQT SESSGDDDAD ADFLHTMNMK KTKETTMFRS  180
HHFHKKTEKE KNTWQEHEEE EDLSLSLSLN HHHWRSNGSS VSETSEAVST CSAPFIFKDC  240
LGSSPKIDLN LDLNLSISLL GS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00030873001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129176.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
SwissprotQ700D96e-77MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A078F8F80.0A0A078F8F8_BRANA; BnaA02g26180D protein
TrEMBLM4ECV80.0M4ECV8_BRARP; Uncharacterized protein
STRINGBra026618.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-61G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]